What is the catalog number for KIR2DS1 Recombinant Protein?

The catalog number for KIR2DS1 Recombinant Protein is OPCA02264-20UG.

What sizes are available for KIR2DS1 Recombinant Protein?

KIR2DS1 Recombinant Protein is available in the following size(s): 20 µg.

Is KIR2DS1 Recombinant Protein in stock?

KIR2DS1 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

KIR2DS1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 1

Gene Aliases

CD158 antigen-like family member H; CD158a; CD158H; killer cell immunoglobulin-like receptor 2DS1; killer cell immunoglobulin-like receptor KIRDS1; killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1; killer-cell immunoglobulin-like receptor; KIR2DS1 Killer-cell Immunoglobulin-like Receptor; MHC class I NK cell receptor Eb6 ActI; p50.1.

Gene ID

3806

Accession Number

NP_055327.1

Reactivity

Homo sapiens|Human

Target

Receptor on natural killer (NK) cells for some HLA-C alleles such as w6. Does not inhibit the activity of NK cells.

Type

Protein

Source

E.coli

Sequence

HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.