Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DS1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 1

Gene Aliases

CD158 antigen-like family member H; CD158a; CD158H; killer cell immunoglobulin-like receptor 2DS1; killer cell immunoglobulin-like receptor KIRDS1; killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1; killer-cell immunoglobulin-like receptor; KIR2DS1 Killer-cell Immunoglobulin-like Receptor; MHC class I NK cell receptor Eb6 ActI; p50.1.

Gene ID

3806

Accession Number

NP_055327.1

Reactivity

Homo sapiens|Human

Target

Receptor on natural killer (NK) cells for some HLA-C alleles such as w6. Does not inhibit the activity of NK cells.

Type

Protein

Source

E.coli

Sequence

HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

28.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

KIR2DS1

Host or Source

Human

Protein Name

Killer cell immunoglobulin-like receptor 2DS1

Gene Name URL

KIR2DS1

Nucleotide Accession Number

NM_014512.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUSP1 (NM_004417) Human Over-expression Lysate
LY401403 100 µg

DUSP1 (NM_004417) Human Over-expression Lysate

Sign In for Pricing
View Details
RGS17 Human Gene Knockout Kit (CRISPR)
KN401859 1 Kit

RGS17 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rttn Mouse Gene Knockout Kit (CRISPR)
KN515200 1 Kit

Rttn Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Autoclave Bags
A9000C 200 Units/Case

Autoclave Bags

Sign In for Pricing
View Details
Cathepsin D (Tumor Marker) (CTSD/2781), CF405S conjugate, 0.1mg/mL
BNC042781-100 1x 100 µL

Cathepsin D (Tumor Marker) (CTSD/2781), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human FGL1 (C-Fc-Avi) Biotinylated
PKSH033855-01 20 µg

Recombinant Human FGL1 (C-Fc-Avi) Biotinylated

Sign In for Pricing
View Details