Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DS1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 1

Gene Aliases

CD158 antigen-like family member H; CD158a; CD158H; killer cell immunoglobulin-like receptor 2DS1; killer cell immunoglobulin-like receptor KIRDS1; killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1; killer-cell immunoglobulin-like receptor; KIR2DS1 Killer-cell Immunoglobulin-like Receptor; MHC class I NK cell receptor Eb6 ActI; p50.1.

Gene ID

3806

Accession Number

NP_055327.1

Reactivity

Homo sapiens|Human

Target

Receptor on natural killer (NK) cells for some HLA-C alleles such as w6. Does not inhibit the activity of NK cells.

Type

Protein

Source

E.coli

Sequence

HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

28.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

KIR2DS1

Host or Source

Human

Protein Name

Killer cell immunoglobulin-like receptor 2DS1

Gene Name URL

KIR2DS1

Nucleotide Accession Number

NM_014512.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOG-1 (DG1/447), CF488A conjugate, 0.1mg/mL
BNC880447-500 1x 500 µL

DOG-1 (DG1/447), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Cecum
CR561088 5 µg

Tissue Total RNA, Cecum

Sign In for Pricing
View Details
Ferritin Light Chain (FTL) Rabbit Monoclonal Antibody
TA423161 100 µL

Ferritin Light Chain (FTL) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human IgM Immunoglobulin (DA4-4), CF594 conjugate, 0.1mg/mL
BNC940759-100 1x 100 µL

Human IgM Immunoglobulin (DA4-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SNRPB2 Rabbit Polyclonal Antibody
TA366171 100 µL

SNRPB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Texas Red Conjugated Goat Affinity Purified Antibody to Human Lambda (Free & Bound)
TAF-008-2 2 mL

Texas Red Conjugated Goat Affinity Purified Antibody to Human Lambda (Free & Bound)

Sign In for Pricing
View Details