Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UGP2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

UDP-glucose pyrophosphorylase 2

Gene Aliases

DEE83; EIEE83; pHC379; SVUGP2; testis tissue sperm-binding protein Li 58p; UDPG; UDP-glucose diphosphorylase; UDP-glucose pyrophosphorylase; UDP-glucose pyrophosphorylase 1; UDPGP; UDPGP2; UGP1; UGPase 2; UGPP1; UGPP2; uridyl diphosphate glucose pyrophosphorylase 2; Uridyl diphosphate glucose pyrophosphorylase-1; UTP-glucose-1-phosphate uridyltransferase; UTP--glucose-1-phosphate uridylyltransferase; UTP--glucose-1-phosphate uridylyltransferase 2.

Gene ID

7360

Accession Number

NP_001001521.1

Reactivity

Homo sapiens|Human

Target

Plays a central role as a glucosyl donor in cellular metabolic pathways.

Type

Protein

Source

E.coli

Sequence

MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

71.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

UGP2

Host or Source

Human

Protein Name

UTP--glucose-1-phosphate uridylyltransferase

Gene Name URL

UGP2

Nucleotide Accession Number

NM_001001521.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

5' 6-FAM / 3' BHQ-1
orb532768 5 to 9 nmol

5' 6-FAM / 3' BHQ-1

Sign In for Pricing
View Details
HIPK3 (Homeodomain Interacting Protein Kinase 3, Androgen Receptor-interacting Nuclear Protein Kinase, ANPK, DYRK6, Fas-interacting Serine/threonine-protein Kinase, FIST, FIST3, Homolog of Protein Kinase YAK1, PKY, YAK1) (MaxLight 405) discontinued
H4065-15-ML405 100 µL

HIPK3 (Homeodomain Interacting Protein Kinase 3, Androgen Receptor-interacting Nuclear Protein Kinase, ANPK, DYRK6, Fas-interacting Serine/threonine-protein Kinase, FIST, FIST3, Homolog of Protein Kinase YAK1, PKY, YAK1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
OTUD4, NT (OTUD4, HIN1, KIAA1046, OTU domain-containing protein 4, HIV-1-induced protein HIN-1) (MaxLight 490) discontinued
039539-ML490 100 µL

OTUD4, NT (OTUD4, HIN1, KIAA1046, OTU domain-containing protein 4, HIV-1-induced protein HIN-1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Slc24a2 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7127802 1.0 µg DNA

Slc24a2 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
MAOA Polyclonal Antibody FITC Conjugated
MBS9463908-01 0.1 mL

MAOA Polyclonal Antibody FITC Conjugated

Sign In for Pricing
View Details
MAOA Polyclonal Antibody FITC Conjugated
MBS9463908-02 5x 0.1 mL

MAOA Polyclonal Antibody FITC Conjugated

Sign In for Pricing
View Details