Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGL2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Fibrinogen like 2

Gene Aliases

Fibrinogen-like protein 2; fibroleukin; pT49; T49.

Gene ID

10875

Reactivity

Homo sapiens|Human

Target

May play a role in physiologic lymphocyte functions at mucosal sites.

Type

Protein

Source

E.coli

Sequence

NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

51.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FGL2

Host or Source

Human

Protein Name

Fibroleukin

Gene Name URL

FGL2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1) ELISA Kit
EIA07770m 1 Kit

Mouse HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1) ELISA Kit

Sign In for Pricing
View Details
Phospho-Tuberin/TSC2 (Ser1387) (D2R3A) Rabbit Monoclonal Antibody
CST 23402T 20 µL

Phospho-Tuberin/TSC2 (Ser1387) (D2R3A) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
LPAR3 Antibody : FITC (OAAF04799-FITC)
OAAF04799-100UG-FITC 100 µg

LPAR3 Antibody : FITC (OAAF04799-FITC)

Sign In for Pricing
View Details
Polyclonal Antibody to A Disintegrin And Metalloproteinase With Thrombospondin 4 (ADAMTS4)
TRV-0058251-01 20 µL

Polyclonal Antibody to A Disintegrin And Metalloproteinase With Thrombospondin 4 (ADAMTS4)

Sign In for Pricing
View Details
Polyclonal Antibody to A Disintegrin And Metalloproteinase With Thrombospondin 4 (ADAMTS4)
TRV-0058251-02 100 µL

Polyclonal Antibody to A Disintegrin And Metalloproteinase With Thrombospondin 4 (ADAMTS4)

Sign In for Pricing
View Details
Polyclonal Antibody to A Disintegrin And Metalloproteinase With Thrombospondin 4 (ADAMTS4)
TRV-0058251-03 200 µL

Polyclonal Antibody to A Disintegrin And Metalloproteinase With Thrombospondin 4 (ADAMTS4)

Sign In for Pricing
View Details