What is the catalog number for LY6E Recombinant Protein?

The catalog number for LY6E Recombinant Protein is OPCA02243-1MG.

What sizes are available for LY6E Recombinant Protein?

LY6E Recombinant Protein is available in the following size(s): 1 mg.

Is LY6E Recombinant Protein in stock?

LY6E Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

LY6E Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Lymphocyte antigen 6 family member E

Gene Aliases

Ly-6E; lymphocyte antigen 6 complex, locus E; lymphocyte antigen 6E; retinoic acid induced gene E; retinoic acid-induced gene E protein; RIGE; RIG-E; SCA2; SCA-2; stem cell antigen 2; thymic shared antigen 1; TSA-1.

Gene ID

4061

Reactivity

Homo sapiens|Human

Target

Involved in T-cell development. Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4-containing nAChRs maximum response.

Type

Protein

Source

E.coli

Sequence

LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol