Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALE Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

UDP-galactose-4-epimerase

Gene Aliases

Epididymis secretory sperm binding protein; galactose-4-epimerase, UDP-; galactowaldenase; SDR1E1; short chain dehydrogenase/reductase family 1E, member 1; UDP galactose-4'-epimerase; UDP-galactose 4-epimerase; UDP-GalNAc 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-glucose 4-epimerase; UDP-N-acetylgalactosamine 4-epimerase; UDP-N-acetylglucosamine 4-epimerase.

Gene ID

2582

Accession Number

NP_000394.2

Reactivity

Homo sapiens|Human

Target

Catalyzes two distinct but analogous reactions: the reversible epimerization of UDP-glucose to UDP-galactose and the reversible epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The reaction with UDP-Gal plays a critical role in the Leloir pathway of galactose catabolism in which galactose is converted to the glycolytic intermediate glucose 6-phosphate. It contributes to the catabolism of dietary galactose and enables the endogenous biosynthesis of both UDP-Gal and UDP-GalNAc when exogenous sources are limited. Both UDP-sugar interconversions are important in the synthesis of glycoproteins and glycolipids.

Type

Protein

Source

E.coli

Sequence

MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

54.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GALE

Host or Source

Human

Protein Name

UDP-glucose 4-epimerase

Gene Name URL

GALE

Nucleotide Accession Number

NM_000403.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta-Hydroxyisovaleric Acid-d8
TRC-H943607-10MG 10 mg

Beta-Hydroxyisovaleric Acid-d8

Sign In for Pricing
View Details
Recombinant Human CXCL10 Protein (His Tag)
PDEH100461-01 20 µg

Recombinant Human CXCL10 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CXCL10 Protein (His Tag)
PDEH100461-02 100 µg

Recombinant Human CXCL10 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CXCL10 Protein (His Tag)
PDEH100461-03 500 µg

Recombinant Human CXCL10 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CXCL10 Protein (His Tag)
PDEH100461-04 1 mg

Recombinant Human CXCL10 Protein (His Tag)

Sign In for Pricing
View Details
TSPAN2 antibody
FNab09059 100 µg

TSPAN2 antibody

Sign In for Pricing
View Details