Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fhit Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Fragile histidine triad gene

Gene Aliases

AP3A hydrolase; AP3Aase; AW045638; bis (5'-adenosyl) -triphosphatase; diadenosine 5',5'''-P1, P3-triphosphate hydrolase; dinucleosidetriphosphatase; Fra1; Fra14A2; fragile histidine triad protein.

Gene ID

14198

Accession Number

NP_001295215.1

Reactivity

Mouse|Mus musculus

Target

Cleaves P (1) -P (3) -bis (5'-adenosyl) triphosphate (Ap3A) to yield AMP and ADP. Can also hydrolyze P (1) -P (4) -bis (5'-adenosyl) tetraphosphate (Ap4A), but has extremely low activity with ATP. Modulates transcriptional activation by CTNNB1 and thereby contributes to regulate the expression of genes essential for cell proliferation and survival, such as CCND1 and BIRC5. Plays a role in the induction of apoptosis via SRC and AKT1 signaling pathways. Inhibits MDM2-mediated proteasomal degradation of p53/TP53 and thereby plays a role in p53/TP53-mediated apoptosis. Induction of apoptosis depends on the ability of FHIT to bind P (1) -P (3) -bis (5'-adenosyl) triphosphate or related compounds, but does not require its catalytic activity (By similarity) . Functions as tumor suppressor.

Type

Protein

Source

E.coli

Sequence

SFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHVLPRKAGDFPRNDNIYDELQKHDREEEDSPAFWRSEKEMAAEAEALRVYFQA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

21.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Fhit

Host or Source

Mouse

Protein Name

Bis (5'-adenosyl) -triphosphatase

Gene Name URL

Fhit

Nucleotide Accession Number

NM_001308286.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDP Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
31600066 1.0 µg DNA

NDP Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Easypro Human IgM (Immunoglobulin M) ELISA Kit
FY-EH3086S 96 Well

Easypro Human IgM (Immunoglobulin M) ELISA Kit

Sign In for Pricing
View Details
Cyclin D2 CRISPR/Cas9 KO Plasmid (h2)
sc-401236-KO-2 20 µg

Cyclin D2 CRISPR/Cas9 KO Plasmid (h2)

Sign In for Pricing
View Details
ARG3 Antibody
orb848458 2 mg

ARG3 Antibody

Sign In for Pricing
View Details
KCNN2 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2495300 100 µL

KCNN2 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Purified anti-human CD163
GT10393 100 µg

Purified anti-human CD163

Sign In for Pricing
View Details