Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cry1Fb Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

132 kDa crystal protein; Crystaline entomocidal protoxin; Insecticidal delta-endotoxin CryIF (b) .

Reactivity

Bacillus thuringiensis

Target

Promotes colloidosmotic lysis by binding to the midgut epithelial cells of insects.

Type

Protein

Source

E.coli

Sequence

VKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEVDNNTDELKFSSNCEKEQVYPGNTVACNDYNKNHGANACSSRNGGYDESYESNSSIPADYAPVYEEEAYTDGQRGNPCEFNRGHTPLPAGYVTAELEYFPETDTVWVEIGETEGTFIVDSVELLLMEE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

47.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CRY1FB

Host or Source

Bacillus thuringiensis subsp. Morrisoni

Protein Name

Pesticidal crystal protein Cry1Fb

Gene Name URL

CRY1FB

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL6R (partial) Peptide
abx266289-01 5 mg

IL6R (partial) Peptide

Sign In for Pricing
View Details
IL6R (partial) Peptide
abx266289-02 10 mg

IL6R (partial) Peptide

Sign In for Pricing
View Details
IL6R (partial) Peptide
abx266289-03 25 mg

IL6R (partial) Peptide

Sign In for Pricing
View Details
Human MET Antibody : FITC (Phospho-Tyr1234/1235)
OAAQ00128-10T 10 Tests

Human MET Antibody : FITC (Phospho-Tyr1234/1235)

Sign In for Pricing
View Details
MraY Antibody
orb821910 2 mg

MraY Antibody

Sign In for Pricing
View Details
Psma8 AAV siRNA Pooled Vector
37952164 1.0 µg

Psma8 AAV siRNA Pooled Vector

Sign In for Pricing
View Details