Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ORF3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

ORF3, Protein ORF3, pORF3

Reactivity

Hepatitis E virus|Hepatitis E Virus

Target

May act as a viral regulatory protein involved in the modulation of mitogenic signaling pathways. May be involved in virion morphogenesis and viral pathogenesis. Expedites the processing and secretion of AMBP from the hepatocyte.

Type

Protein

Source

E.coli

Sequence

MGSRPWALGLFCCCSSCFCLCCSRHRPVSRLAAVVGGAAAVPAVVSGVTGLILSPSQSPIFIQPTPSPRMSPLRPGLDLVFANPSDHSAPLGATRPSAPPLPHVVDLPQLGPRR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

27.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ORF3

Host or Source

Hepatitis E virus genotype 1

Protein Name

Protein ORF3

Gene Name URL

ORF3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF568 conjugate, 0.1mg/mL
BNC681919-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human TUBG1/TUBG protein (His tag)
PDEH101031-01 20 µg

Recombinant Human TUBG1/TUBG protein (His tag)

Sign In for Pricing
View Details
Recombinant Human TUBG1/TUBG protein (His tag)
PDEH101031-02 100 µg

Recombinant Human TUBG1/TUBG protein (His tag)

Sign In for Pricing
View Details
Recombinant Human TUBG1/TUBG protein (His tag)
PDEH101031-03 500 µg

Recombinant Human TUBG1/TUBG protein (His tag)

Sign In for Pricing
View Details
Recombinant Human TUBG1/TUBG protein (His tag)
PDEH101031-04 1 mg

Recombinant Human TUBG1/TUBG protein (His tag)

Sign In for Pricing
View Details
Human TMEM144 activation kit by CRISPRa
GA110695 1 Kit

Human TMEM144 activation kit by CRISPRa

Sign In for Pricing
View Details