SRSF10 Recombinant Protein

40 kDa SR-repressor protein; FUS interacting protein (serine-arginine rich) 1; FUS-interacting protein (serine-arginine rich) 2; FUS-interacting serine-arginine-rich protein 1; FUSIP1; FUSIP2; neural-salient SR protein; NSSR; PPP1R149; protein phosphatase 1, regulatory subunit 149; serine/arginine-rich splicing factor 10; serine-arginine repressor protein (40 kDa) ; SFRS13; SFRS13A; splicing factor SRp38; splicing factor, arginine/serine-rich 13; splicing factor, arginine/serine-rich 13A; SR splicing factor 10; SRp38; SRrp40; TASR; TASR1; TASR2; TLS-associated protein TASR; TLS-associated protein with Ser-Arg repeats; TLS-associated protein with SR repeats; TLS-associated serine-arginine protein; TLS-associated serine-arginine protein 1; TLS-associated serine-arginine protein 2; TLS-associated SR protein.

Splicing factor that in its dephosphorylated form acts as a general repressor of pre-mRNA splicing (PubMed:11684676, PubMed:12419250, PubMed:14765198) . Seems to interfere with the U1 snRNP 5'-splice recognition of SNRNP70 (PubMed:14765198) . Required for splicing repression in M-phase cells and after heat shock (PubMed:14765198) . Also acts as a splicing factor that specifically promotes exon skipping during alternative splicing (PubMed:26876937) . Interaction with YTHDC1, a RNA-binding protein that recognizes and binds N6-methyladenosine (m6A) -containing RNAs, prevents SRSF10 from binding to its mRNA-binding sites close to m6A-containing regions, leading to inhibit exon skipping during alternative splicing (PubMed:26876937) . May be involved in regulation of alternative splicing in neurons, with isoform 1 acting as a positive and isoform 3 as a negative regulator (PubMed:12419250) .

MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRPNCSWNTQYSSAYYTSRKI

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.