Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YoaJ Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Extracellular endoglucanase precursor (expansin)

Gene Aliases

BSU_18630; BSU18630; EXLX1; extracellular endoglucanase precursor (expansin) .

Gene ID

940108

Accession Number

NP_389744.1

Reactivity

Bacillus subtilis

Target

May promote colonization of plant roots. May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. Has very low expansin activity (in vitro) . No enzymatic activity has been found. Binds to peptidoglycan and to plant cell walls.

Type

Protein

Source

E.coli

Sequence

AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ExlX

Host or Source

Bacillus subtilis

Protein Name

Expansin-YoaJ

Gene Name URL

ExlX

Nucleotide Accession Number

NC_000964.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIOX 3'UTR Lenti-reporter-Luc Vector
28608081 1.0 µg

MIOX 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
PSME2 (Proteasome Activator Complex Subunit 2, Proteasome Activator 28 Subunit beta, PA28beta, PA28b, Activator Of MultiCatalytic Protease Subunit 2, 11S Regulator Complex Subunit beta, REG-beta) (HRP)
207855-HRP 100 µL

PSME2 (Proteasome Activator Complex Subunit 2, Proteasome Activator 28 Subunit beta, PA28beta, PA28b, Activator Of MultiCatalytic Protease Subunit 2, 11S Regulator Complex Subunit beta, REG-beta) (HRP)

Sign In for Pricing
View Details
CD175 (Tn) (MaxLight 405) discontinued
C2548-90V-ML405 100 µL

CD175 (Tn) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rabbit Monoclonal CD37 Antibody (IPO-24 (ZC37-24)) [HRP]
NBP3-12074H 0.1 mL

Rabbit Monoclonal CD37 Antibody (IPO-24 (ZC37-24)) [HRP]

Sign In for Pricing
View Details
PPP1R10P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV773100 1.0 µg DNA

PPP1R10P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Anti-CYP11B1/C11B2/CYP11B2 Antibody Picoband®, Dylight550 Conjugate
A03766-3-Dylight550 100 µg

Anti-CYP11B1/C11B2/CYP11B2 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details