Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SVTLE Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Fibrinogen-clotting enzyme; Snake venom serine protease 2.

Reactivity

Crotalus adamanteus

Target

Thrombin-like snake venom protein that release fibrinopeptide A from fibrinogen (FGA) . Shows both kinin-releasing and coagulant activities.

Type

Protein

Source

E.coli

Sequence

VIGGDECNINEHRFLVALYDYWSQSFLCGGTLINEEWVLTAKHCDRTHILIYVGVHDRSVQFDKEQRRFPKEKYFFDCSNNFTKWDKDIMLIRLNKPVSYSEHIAPLSLPSSPPIVGSVCRAMGWGQTTSPQETLPDVPHCANINLLDYEVCRTAHPQFRLPATSRTLCAGVLEGGIDTCNRDSGGPLICNGQFQGIVFWGPDPCAQPDKPGLYTKVFDHLDWIQSIIAGEKTVNCPP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

42.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SVTLE

Host or Source

Crotalus adamanteus

Protein Name

Thrombin-like enzyme crotalase

Gene Name URL

SVTLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPDYE3 Rabbit pAb
orb2711036-01 50 µL

SPDYE3 Rabbit pAb

Sign In for Pricing
View Details
SPDYE3 Rabbit pAb
orb2711036-02 100 µL

SPDYE3 Rabbit pAb

Sign In for Pricing
View Details
LIN28B (NM_001004317) Human Over-expression Lysate
LS389421-100ug 100 µg

LIN28B (NM_001004317) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human SIRT6 Protein, N-His
orb3060759-01 50 µg

Recombinant Human SIRT6 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human SIRT6 Protein, N-His
orb3060759-02 100 µg

Recombinant Human SIRT6 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human SIRT6 Protein, N-His
orb3060759-03 1 mg

Recombinant Human SIRT6 Protein, N-His

Sign In for Pricing
View Details