What is the catalog number for FkpA Recombinant Protein?

The catalog number for FkpA Recombinant Protein is OPCA02198-1MG.

What sizes are available for FkpA Recombinant Protein?

FkpA Recombinant Protein is available in the following size(s): 1 mg.

Is FkpA Recombinant Protein in stock?

FkpA Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

FkpA Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Rotamase.

Accession Number

WP_011704938.1

Reactivity

Aeromonas hydrophila

Target

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. FkpA probably acts in the folding of extracytoplasmic proteins.

Type

Protein

Source

E.coli

Sequence

CQKDEKTAANTAEVKAEASKPAEAPKAEAKSFEEQSGYAIGLSMGRYIANTLERQQELGIKLDNSVILKGVTDGLGKEAKMTDEEIQKVLQQYDAKINELTKAKADKDAVENQKKGEEYLAANAKKEGVKSTESGLQYQVEKMGTGAKPKATDIVKVHYTGTLTDGTKFDSSVDRGEPATFPLNQVIPGWTEGVQLMPVGSKFKFFLPSKLAYGEHGAGSIPANAVLVFDVELLAIEKPAADGDNAKK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.