Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kunitz-type neurotoxin MitTx-alpha Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Kunitz-type neurotoxin MitTx-alpha

Reactivity

Micrurus tener

Target

MitTx, a heteromeric complex between Kunitz- and phospholipase-A2-like proteins, potently, persistently and selectively activates rat and chicken acid-sensing ion channel ASIC1 (PubMed:22094702, PubMed:24507937) . Both alternatively spliced rat isoforms ASIC1a and ASIC1b are activated, with a higher potency for ASIC1a (EC (50) =9.4 nM) vs ASIC1b (EC (50) =23 nM) (PubMed:22094702) . The rat ASIC3 subtype is also sensitive to the heterodimer, but with a lower potency (EC (50) =830 nM) (PubMed:22094702) . On rat ASIC2a, the toxin shows a very weak activation, but produces a remarkable potentiation (>100-fold) of protons when the extracellular pH drops below neutrality (PubMed:22094702) . Moderate and weak activations are also observed on the heterotrimers Asic1a-Asic2a and Asic1a-Asic3 (expressed in CHO cells), respectively (PubMed:22094702) . The binding sites of the beta subunit of MitTx and the spider psalmotoxin-1 overlap, explaining why these toxins are mutually exclusive (PubMed:22094702. PubMed:24507937) . In vivo, the heterodimer elicits robust pain-related behavior in mice by activation of ASIC1 channels on capsaicin-sensitive nerve fibers (PubMed:22094702) .

Type

Protein

Source

E.coli

Sequence

QIRPAFCYEDPPFFQKCGAFVDSYYFNRSRITCVHFFYGQCDVNQNHFTTMSECNRVCHG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

23.1 kDa

Protein Length

Recombinant

Host or Source

Micrurus tener tener

Protein Name

Kunitz-type neurotoxin MitTx-alpha

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EWSR1 Peptide
orb2017465 100 µg

EWSR1 Peptide

Sign In for Pricing
View Details
Human ZBTB4 shRNA Plasmid
abx961612-01 150 µg

Human ZBTB4 shRNA Plasmid

Sign In for Pricing
View Details
Human ZBTB4 shRNA Plasmid
abx961612-02 300 µg

Human ZBTB4 shRNA Plasmid

Sign In for Pricing
View Details
Mouse Anti-NiV F1 Monoclonal Antibody, clone 5G7
CABT-NS1194 200 μg

Mouse Anti-NiV F1 Monoclonal Antibody, clone 5G7

Sign In for Pricing
View Details
GCNT1P sgRNA CRISPR Lentivector set (Human)
K0847701 3x 1.0 µg

GCNT1P sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
AICDA Knockout HEK293T Cell Line
ARG43710 1 Million

AICDA Knockout HEK293T Cell Line

Sign In for Pricing
View Details