Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NSP4 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Assembly protein

Gene Aliases

NCVP5; NS28.

Gene ID

7011361

Accession Number

YP_002302223.1

Reactivity

Human Rotavirus A|Rotavirus A

Target

Plays an essential role in the virus replication cycle by acting as a viroporin. Creates a pore in the host reticulum endoplasmic and as a consequence releases Ca (2+) in the cytoplasm of infected cell. In turn, high levels of cytoplasmic calcium trigger membrane trafficking and transport of viral ER-associated proteins to viroplasms, sites of viral genome replication and immature particle assembly.

Type

Protein

Source

E.coli

Sequence

PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQTTGEIDMTKEINQKNVRTLEEWESGKNPYEPREVTAAM

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.6 kDa

Protein Length

Recombinant

Host or Source

Rotavirus A

Protein Name

Non-structural glycoprotein 4

Nucleotide Accession Number

NC_011504.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGBD1 siRNA Oligos set (Human)
36483171 3x 5 nmol

PGBD1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Canine Rho GTPase activating protein 15 (ARHGAP15) ELISA Kit
GTR10367513 96 Well

Canine Rho GTPase activating protein 15 (ARHGAP15) ELISA Kit

Sign In for Pricing
View Details
ELISA Kit For Transcription factor Sp7
E4797m 96 Tests

ELISA Kit For Transcription factor Sp7

Sign In for Pricing
View Details
Recombinant Bacillus cereus Elongation factor Tu (tuf)
MBS1445548-01 0.02 mg (E-Coli)

Recombinant Bacillus cereus Elongation factor Tu (tuf)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Elongation factor Tu (tuf)
MBS1445548-02 0.02 mg (Yeast)

Recombinant Bacillus cereus Elongation factor Tu (tuf)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Elongation factor Tu (tuf)
MBS1445548-03 0.1 mg (E-Coli)

Recombinant Bacillus cereus Elongation factor Tu (tuf)

Sign In for Pricing
View Details