Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LolA Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

LolA, EcHS_A0996, Outer-membrane lipoprotein carrier protein

Accession Number

WP_001295343.1

Reactivity

Escherichia coli

Target

Participates in the translocation of lipoproteins from the inner membrane to the outer membrane. Only forms a complex with a lipoprotein if the residue after the N-terminal Cys is not an aspartate (The Asp acts as a targeting signal to indicate that the lipoprotein should stay in the inner membrane) .

Type

Protein

Source

E.coli

Sequence

DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

24.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LOLA

Host or Source

Escherichia coli

Protein Name

Outer-membrane lipoprotein carrier protein

Gene Name URL

LOLA

Nucleotide Accession Number

NC_009800.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actin Antibody
PHY3428S 150 μg

Actin Antibody

Sign In for Pricing
View Details
Lentiviral mouse Slc30a9 shRNA (UAS) - Lentiviral mouse Slc30a9 shRNA (UAS, RFP) (100)
GTR15211392 1 Vial

Lentiviral mouse Slc30a9 shRNA (UAS) - Lentiviral mouse Slc30a9 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
TRAP (N-term) Rabbit pAb
E2619965 100 µL

TRAP (N-term) Rabbit pAb

Sign In for Pricing
View Details
Miconazole Nitrate
41310012-2 5 g

Miconazole Nitrate

Sign In for Pricing
View Details
Anti-DLL4 (Rabbit, Monoclonal)
A107673 100 µL

Anti-DLL4 (Rabbit, Monoclonal)

Sign In for Pricing
View Details
Sad1 And UNC84 Domain Containing 1 (SUN1) Antibody
abx340222-01 100 µg

Sad1 And UNC84 Domain Containing 1 (SUN1) Antibody

Sign In for Pricing
View Details