Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

GGlycoprotein

Reactivity

Rabies Virus

Target

Attaches the virus to host cellular receptor, inducing endocytosis of the virion. In the endosome, the acidic pH induces conformational changes in the glycoprotein trimer, which trigger fusion between virus and cell membrane. There is convincing in vitro evidence that the muscular form of the nicotinic acetylcholine receptor (nAChR), the neuronal cell adhesion molecule (NCAM), and the p75 neurotrophin receptor (p75NTR) bind glycoprotein and thereby facilitate rabies virus entry into cells (By similarity) .

Type

Protein

Source

E.coli

Sequence

KFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVKTTKESLVIISPSVADLDPYDKSLHSRVFPSGKCSGITISSTYCSTNHDYTIWMPENPRLGTSCDIFTNSRGKRASKGGKTCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMATKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLRVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLESSVIPLMHPLADPSTVFKDGDEAEDFVEVHLPDVHKQISGVDLGLPSWGKY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

65.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

G

Host or Source

Rabies virus

Protein Name

Glycoprotein

Gene Name URL

G

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDT1 Antibody
E95474 100 µg

NUDT1 Antibody

Sign In for Pricing
View Details
2010003K11Rik (NM_027237) Mouse Recombinant Protein
TP500639 20 µg

2010003K11Rik (NM_027237) Mouse Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human CD4/LEU3 Protein (Fc Tag)
PKSH033507-01 10 µg

Recombinant Human CD4/LEU3 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human CD4/LEU3 Protein (Fc Tag)
PKSH033507-02 50 µg

Recombinant Human CD4/LEU3 Protein (Fc Tag)

Sign In for Pricing
View Details
HTATSF1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
24058156 3x 1.0 µg DNA

HTATSF1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Tolcaine HCl
orb1695036 25 mg

Tolcaine HCl

Sign In for Pricing
View Details