Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

2.5 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Single-stranded DNA-binding protein

Gene Aliases

Single-stranded DNA-binding protein; T7p17.

Gene ID

1261080

Accession Number

NP_523311.1

Reactivity

Enterobacteria phage T3|Enterobacteria phage T7|Erischia phage T7

Target

Single-stranded DNA-binding protein that eliminates secondary structure in long ssDNA formed on the lagging strand of the replication fork. Stimulates DNA polymerase activity and increases the efficiency of RNA primer synthesis by interacting with the DNA polymerase and the helicase/primase protein gp4. Disrupts loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation.

Type

Protein

Source

E.coli

Sequence

MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

41.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

T7p17

Host or Source

Enterobacteria phage T7

Protein Name

Single-stranded DNA-binding protein gp2.5

Gene Name URL

T7p17

Nucleotide Accession Number

NC_003298.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NARS Rabbit Polyclonal Antibody
HA500479 100 µL

NARS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Benzyl Alternariol
TRC-B209975-50MG 50 mg

Benzyl Alternariol

Sign In for Pricing
View Details
SENP8 Rabbit Polyclonal Antibody
AP06462PU-N 100 µg

SENP8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant CaMKII (phospho T286) Antibody
RC-16651-01 50 μL

Recombinant CaMKII (phospho T286) Antibody

Sign In for Pricing
View Details
Recombinant CaMKII (phospho T286) Antibody
RC-16651-02 100 µL

Recombinant CaMKII (phospho T286) Antibody

Sign In for Pricing
View Details
Recombinant CaMKII (phospho T286) Antibody
RC-16651-03 1 mL

Recombinant CaMKII (phospho T286) Antibody

Sign In for Pricing
View Details