Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EntC1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

SEC1.

Reactivity

Staphylococcus aureus

Target

Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death.

Type

Protein

Source

E.coli

Sequence

ESQPDPTPDELHKASKFTGLMENMKVLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEGLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

43.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ENTC1

Host or Source

Staphylococcus aureus

Protein Name

Enterotoxin type C-1

Gene Name URL

ENTC1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SKP1 Rabbit pAb
A12505 100 µL

SKP1 Rabbit pAb

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) BTS Polyclonal Antibody
MBS7143017 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) BTS Polyclonal Antibody

Sign In for Pricing
View Details
GAS2L1, CT (GAS2L1, GAR22, GAS2-like protein 1, GAS2-related protein on chromosome 22, Growth arrest-specific protein 2-like 1) (APC)
MBS6301281-01 0.2 mL

GAS2L1, CT (GAS2L1, GAR22, GAS2-like protein 1, GAS2-related protein on chromosome 22, Growth arrest-specific protein 2-like 1) (APC)

Sign In for Pricing
View Details
GAS2L1, CT (GAS2L1, GAR22, GAS2-like protein 1, GAS2-related protein on chromosome 22, Growth arrest-specific protein 2-like 1) (APC)
MBS6301281-02 5x 0.2 mL

GAS2L1, CT (GAS2L1, GAR22, GAS2-like protein 1, GAS2-related protein on chromosome 22, Growth arrest-specific protein 2-like 1) (APC)

Sign In for Pricing
View Details
SLC19A3 Protein Vector (Human) (pPM-C-HA)
43921021 500 ng

SLC19A3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Human KLK4 Protein, C-His
EHK03501 100 μg

Recombinant Human KLK4 Protein, C-His

Sign In for Pricing
View Details