Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Complement component 3

Gene Aliases

Acylation stimulating protein; AI255234; ASP; complement C3; complement component 3d; complement factor 3; HSE-MSF; Plp.

Gene ID

12266

Accession Number

NP_033908.2

Reactivity

Mouse|Mus musculus

Target

C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.

Type

Protein

Source

E.coli

Sequence

SEETKQNEAFSLTAKGKGRGTLSVVAVYHAKLKSKVTCKKFDLRVSIRPAPETAKKPEEAKNTMFLEICTKYLGDVDATMSILDISMMTGFAPDTKDLELLASGVDRYISKYEMNKAFSNKNTLIIYLEKISHTEEDCLTFKVHQYFNVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDGMLSKLCHSEMCRCAEENCFMQQSQEKINLNVRLDKACEPGVDYVYKTELTNIELLDDFDEYTMTIQQVIKSGSDEVQAGQQRKFISHIKCRNALKLQKGKKYLMWGLSSDLWGEKPNTSYIIGKDTWVEHWPEAEECQDQKYQKQCEELGAFTESMVVYGCPN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

55.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

C3

Host or Source

Mouse

Protein Name

Complement C3

Gene Name URL

C3

Nucleotide Accession Number

NM_009778.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Capsl qPCR Primer Pair
QM44010S 200 Tests

Mouse Capsl qPCR Primer Pair

Sign In for Pricing
View Details
Ssrp1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7036506 1.0 µg DNA

Ssrp1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type N2 (PTPRN2)
MBS2072074-01 0.1 mL

PE-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type N2 (PTPRN2)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type N2 (PTPRN2)
MBS2072074-02 0.2 mL

PE-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type N2 (PTPRN2)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type N2 (PTPRN2)
MBS2072074-03 0.5 mL

PE-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type N2 (PTPRN2)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type N2 (PTPRN2)
MBS2072074-04 1 mL

PE-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type N2 (PTPRN2)

Sign In for Pricing
View Details