Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RuvC Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Crossover junction endodeoxyribonuclease RuvC

Gene Aliases

B1863; crossover junction endodeoxyribonuclease RuvC; ECK1864; Holliday junction nuclease RuvC; Holliday junction resolvase RuvC.

Gene ID

946378

Accession Number

NP_416377.1

Reactivity

Escherichia coli

Target

Nuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves the cruciform structure in supercoiled DNA by nicking to strands with the same polarity at sites symmetrically opposed at the junction in the homologous arms and leaves a 5'-terminal phosphate and a 3'-terminal hydroxyl group.

Type

Protein

Source

E.coli

Sequence

AIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQMSESRLNLARGRLR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

34.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RuvC

Host or Source

Escherichia coli

Protein Name

Crossover junction endodeoxyribonuclease RuvC

Gene Name URL

RuvC

Nucleotide Accession Number

NC_000913.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDGF Antibody - middle region (ARP84390_P050)
ARP84390_P050 100 µL

HDGF Antibody - middle region (ARP84390_P050)

Sign In for Pricing
View Details
FOXO4 antibody - middle region (AVARP01018_P050)
AVARP01018_P050 100 µL

FOXO4 antibody - middle region (AVARP01018_P050)

Sign In for Pricing
View Details
WIF1 (WNT Inhibitory Factor 1)
365595 200 µL

WIF1 (WNT Inhibitory Factor 1)

Sign In for Pricing
View Details
Recombinant Human CD137 Protein
MBS8304882-01 0.01 mg

Recombinant Human CD137 Protein

Sign In for Pricing
View Details
Recombinant Human CD137 Protein
MBS8304882-02 0.05 mg

Recombinant Human CD137 Protein

Sign In for Pricing
View Details
Recombinant Human CD137 Protein
MBS8304882-03 0.5 mg

Recombinant Human CD137 Protein

Sign In for Pricing
View Details