Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RuvB Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Holliday junction branch migration complex subunit RuvB

Gene Aliases

B1860; ECK1861; Holliday junction branch migration complex subunit RuvB.

Gene ID

946371

Accession Number

NP_416374.1

Reactivity

Escherichia coli

Target

The RuvA-RuvB complex in the presence of ATP renatures cruciform structure in supercoiled DNA with palindromic sequence, indicating that it may promote strand exchange reactions in homologous recombination. RuvAB is a helicase that mediates the Holliday junction migration by localized denaturation and reannealing.

Type

Protein

Source

E.coli

Sequence

MIEADRLISAGTTLPEDVADRAIRPKLLEEYVGQPQVRSQMEIFIKAAKLRGDALDHLLIFGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAMLTNLEPHDVLFIDEIHRLSPVVEEVLYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEFYQVPDLQYIVSRSARFMGLEMSDDGALEVARRARGTPRIANRLLRRVRDFAEVKHDGTISADIAAQALDMLNVDAEGFDYMDRKLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDVLEPYLIQQGFLQRTPRGRMATTRAWNHFGITPPEMP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

53.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RuvB

Host or Source

Escherichia coli

Protein Name

Holliday junction ATP-dependent DNA helicase RuvB

Gene Name URL

RuvB

Nucleotide Accession Number

NC_000913.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA2 (Carbonic Anhydrase 2, Carbonate Dehydratase II, Carbonic Anhydrase C, CAC, CAII, Car2, CA-II) (Biotin)
MBS6409151-01 0.1 mL

CA2 (Carbonic Anhydrase 2, Carbonate Dehydratase II, Carbonic Anhydrase C, CAC, CAII, Car2, CA-II) (Biotin)

Sign In for Pricing
View Details
CA2 (Carbonic Anhydrase 2, Carbonate Dehydratase II, Carbonic Anhydrase C, CAC, CAII, Car2, CA-II) (Biotin)
MBS6409151-02 5x 0.1 mL

CA2 (Carbonic Anhydrase 2, Carbonate Dehydratase II, Carbonic Anhydrase C, CAC, CAII, Car2, CA-II) (Biotin)

Sign In for Pricing
View Details
Phenylalanyl-tRNA synthetase, beta subunit
328123 100 µL

Phenylalanyl-tRNA synthetase, beta subunit

Sign In for Pricing
View Details
MLLT6, CT (Protein AF-17, ALL1-fused Gene From Chromosome 17 Protein, AF17) (MaxLight 490)
MBS6488407-01 0.1 mL

MLLT6, CT (Protein AF-17, ALL1-fused Gene From Chromosome 17 Protein, AF17) (MaxLight 490)

Sign In for Pricing
View Details
MLLT6, CT (Protein AF-17, ALL1-fused Gene From Chromosome 17 Protein, AF17) (MaxLight 490)
MBS6488407-02 5x 0.1 mL

MLLT6, CT (Protein AF-17, ALL1-fused Gene From Chromosome 17 Protein, AF17) (MaxLight 490)

Sign In for Pricing
View Details
CD200R Polyclonal Antibody, PE-Cy7 Conjugated
bs-7351R-PE-Cy7 100 µL

CD200R Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details