Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mpt51 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Mpt51, fbpC1, fbpD, mpb51, MT3910, MPT51/MPB51 antigen

Reactivity

Mycobacterium tuberculosis

Target

May have a role in host tissue attachment, whereby ligands may include the serum protein fibronectin and small sugars.

Type

Protein

Source

E.coli

Sequence

AEPTAKAAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGAMSGDIVGAIR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

44.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MPT51

Host or Source

Mycobacterium tuberculosis

Protein Name

MPT51/MPB51 antigen

Gene Name URL

MPT51

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Oryza sativa subsp. japonica (Rice) LIR1 Polyclonal Antibody
MBS9000857 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) LIR1 Polyclonal Antibody

Sign In for Pricing
View Details
IHH cDNA Clone
MBS1273034-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

IHH cDNA Clone

Sign In for Pricing
View Details
IHH cDNA Clone
MBS1273034-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

IHH cDNA Clone

Sign In for Pricing
View Details
DDB1 (DNA Damage-binding Protein 1, DDB p127 Subunit, DNA Damage-binding Protein a, DDBa, Damage-specific DNA-binding Protein 1, HBV X-associated Protein 1, XAP-1, UV-damaged DNA-binding Factor, UV-damaged DNA-binding Protein 1, UV-DDB 1, XPE-binding Factor, XPE-BF, Xeroderma pigmentosum Group E-complementing Protein, XPCe, XAP1) (HRP)
125700-HRP 100 µL

DDB1 (DNA Damage-binding Protein 1, DDB p127 Subunit, DNA Damage-binding Protein a, DDBa, Damage-specific DNA-binding Protein 1, HBV X-associated Protein 1, XAP-1, UV-damaged DNA-binding Factor, UV-damaged DNA-binding Protein 1, UV-DDB 1, XPE-binding Factor, XPE-BF, Xeroderma pigmentosum Group E-complementing Protein, XPCe, XAP1) (HRP)

Sign In for Pricing
View Details
Anti-PON2 Antibody Picoband®, Dylight550 Conjugate
A02027-2-Dylight550 100 µg

Anti-PON2 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
MTA1 Rabbit Polyclonal Antibody (BF350)
orb1975325 100 µL

MTA1 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details