Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FimH Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Type 1 fimbriae D-mannose specific adhesin

Gene Aliases

B4320; ECK4311; pilE; Protein FimH; type 1 fimbriae D-mannose specific adhesin.

Gene ID

948847

Accession Number

NP_418740.1

Reactivity

Escherichia coli

Target

Involved in regulation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae) . Adhesin responsible for the binding to D-mannose. It is laterally positioned at intervals in the structure of the type 1 fimbriae. In order to integrate FimH in the fimbriae FimF and FimG are needed.

Type

Protein

Source

E.coli

Sequence

FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

Varies by lot. See vial for exact concentration.

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

59.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FimH

Host or Source

Escherichia coli

Protein Name

Type 1 fimbrin D-mannose specific adhesin

Gene Name URL

FimH

Nucleotide Accession Number

NC_000913.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-hsa-miR-6762-5p Vector
mh42399 500 ng

LentimiRa-hsa-miR-6762-5p Vector

Sign In for Pricing
View Details
SLC8A3 Human Pre-designed siRNA Set A
HY-RS13339 1 Set

SLC8A3 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
1- (3-Chloro-4-fluorophenyl) piperazine dihydrochloride
sc-281787A 5 g

1- (3-Chloro-4-fluorophenyl) piperazine dihydrochloride

Sign In for Pricing
View Details
DIAPH2, ID (DIAPH2, DIA, Protein diaphanous homolog 2, Diaphanous-related formin-2)
034640 200 µL

DIAPH2, ID (DIAPH2, DIA, Protein diaphanous homolog 2, Diaphanous-related formin-2)

Sign In for Pricing
View Details
Rat Fibronectin Type III Domain Containing Protein 5 (FNDC5) ELISA Kit
orb2813530-01 48 Tests

Rat Fibronectin Type III Domain Containing Protein 5 (FNDC5) ELISA Kit

Sign In for Pricing
View Details
Rat Fibronectin Type III Domain Containing Protein 5 (FNDC5) ELISA Kit
orb2813530-02 96 Tests

Rat Fibronectin Type III Domain Containing Protein 5 (FNDC5) ELISA Kit

Sign In for Pricing
View Details