Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

E2, Regulatory protein E2

Reactivity

Human papillomavirus type 18|Human Papillomavirus Type 18

Target

Plays a role in the initiation of viral DNA replication. A dimer of E2 interacts with a dimer of E1 in order to improve specificity of E1 DNA binding activity. Once the complex recognizes and binds DNA at specific sites, the E2 dimer is removed from DNA. E2 also regulates viral transcription through binding to the E2RE response element (5'-ACCNNNNNNGGT-3') present in multiple copies in the regulatory regions of the viral genome. Activates or represses transcription depending on E2RE's position with regards to proximal promoter elements including the TATA-box. Repression occurs by sterically hindering the assembly of the transcription initiation complex.

Type

Protein

Source

E.coli

Sequence

MQTPKETLSERLSCVQDKIIDHYENDSKDIDSQIQYWQLIRWENAIFFAAREHGIQTLNHQVVPAYNISKSKAHKAIELQMALQGLAQSAYKTEDWTLQDTCEELWNTEPTHCFKKGGQTVQVYFDGNKDNCMTYVAWDSVYYMTDAGTWDKTATCVSHRGLYYVKEGYNTFYIEFKSECEKYGNTGTWEVHFGNNVIDCNDSMCSTSDDTVSATQLVKQLQHTPSPYSSTVSVGTAKTYGQTSAATRPGHCGLAEKQHCGPVNPLLGAATPTGNNKRRKLCSGNTTPIIHLKGDRNSLKCLRYRLRKHSDHYRDISSTWHWTGAGNEKTGILTVTYHSETQRTKFLNTVAIPDSVQILVGYMTM

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

45.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

E2

Host or Source

Human papillomavirus type 18

Protein Name

Regulatory protein E2

Gene Name URL

E2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (MUC1/967), CF647 conjugate, 0.1mg/mL
BNC470967-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/967), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF670 Mouse Monoclonal Antibody [Clone ID: OTI6H9]
CF811126 100 µg

ZNF670 Mouse Monoclonal Antibody [Clone ID: OTI6H9]

Sign In for Pricing
View Details
PIK3IP1 (NM_001135911) Human Over-expression Lysate
LC427727 20 µg

PIK3IP1 (NM_001135911) Human Over-expression Lysate

Sign In for Pricing
View Details
EGFR Rabbit Polyclonal Antibody
AP20975PU-N 100 µg

EGFR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS806504 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
Epiandrosterone
TRC-E578000-250MG 250 mg

Epiandrosterone

Sign In for Pricing
View Details