Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mup8 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Major urinary protein 11|major urinary protein 18

Gene Aliases

100039228; alpha-2U-globulin; Gm12549; Gm12561; group 1, BS6; major urinary protein 11; major urinary protein 16; Major urinary protein 18; Major urinary protein 6; major urinary protein 9; MUP 6; Mup16; Mup18; Mup6; Mup9.

Gene ID

100039028|100048884

Accession Number

NP_001157998.1

Reactivity

Mouse|Mus musculus

Target

Major urinary proteins (Mups) bind pheromones, and thus stabilize them to allow slow release into the air from urine marks. May protect pheromones from oxidation. May also act as pheromones themselves. In this context, they play a role in the regulation of social behaviors, such as aggression, mating, pup-suckling, territory establishment and dominance (Probable) . Binds the pheromone analog 2-sec-butyl-4,5-dihydrothiazole (SBT) in vitro (PubMed:25279835) .

Type

Protein

Source

E.coli

Sequence

REKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

21.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Mup11|Mup18

Host or Source

Mouse

Protein Name

Major urinary protein 11

Gene Name URL

Mup11|Mup18

Nucleotide Accession Number

NM_001164526.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-ZNF589 antibody
SL19527R-01 50 µL

Rabbit Anti-ZNF589 antibody

Sign In for Pricing
View Details
Rabbit Anti-ZNF589 antibody
SL19527R-02 100 µL

Rabbit Anti-ZNF589 antibody

Sign In for Pricing
View Details
Urb1 AAV siRNA Pooled Vector
49245164 1.0 µg

Urb1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
FLASK RB, 1 CN 34/35 & 1 ASN 19/26 I/C J
4381A33 1 Unit

FLASK RB, 1 CN 34/35 & 1 ASN 19/26 I/C J

Sign In for Pricing
View Details
Bovine Fibrinogen (FG) ELISA Kit
orb1666423-01 48 Tests

Bovine Fibrinogen (FG) ELISA Kit

Sign In for Pricing
View Details
Bovine Fibrinogen (FG) ELISA Kit
orb1666423-02 96 Tests

Bovine Fibrinogen (FG) ELISA Kit

Sign In for Pricing
View Details