Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gp120 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Envelope surface glycoprotein gp160, precursor

Gene Aliases

Env polyprotein; Envelope surface glycoprotein gp160, precursor; HIV1gp8.

Gene ID

155971

Accession Number

NP_057856.1

Reactivity

Human Immunodeficiency Virus Type 1

Target

Envelope glycoprotein gp160: Oligomerizes in the host endoplasmic reticulum into predominantly trimers. In a second time, gp160 transits in the host Golgi, where glycosylation is completed. The precursor is then proteolytically cleaved in the trans-Golgi and thereby activated by cellular furin or furin-like proteases to produce gp120 and gp41.

Type

Protein

Source

E.coli

Sequence

KLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLVNVTENFNMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKGEIKNCSFNISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYKLTSCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVNFTDNAKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNISRAKWNNTLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFNSTWFNSTWSTEGSNNTEGSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNITGLLLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

69.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Env

Host or Source

Human immunodeficiency virus type 1 group M subtype B

Protein Name

Envelope glycoprotein gp160

Gene Name URL

Env

Nucleotide Accession Number

NC_001802.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Colon: sigmoid
CR561568 5 µg

Tissue Total RNA, Colon: sigmoid

Sign In for Pricing
View Details
Human FUZ activation kit by CRISPRa
GA112862 1 Kit

Human FUZ activation kit by CRISPRa

Sign In for Pricing
View Details
SYPL1 Human Knockdown Lysate
LY300306 100 µg

SYPL1 Human Knockdown Lysate

Sign In for Pricing
View Details
TNFRSF21 Antibody
KC-23324-01 50 μL

TNFRSF21 Antibody

Sign In for Pricing
View Details
TNFRSF21 Antibody
KC-23324-02 100 µL

TNFRSF21 Antibody

Sign In for Pricing
View Details
TNFRSF21 Antibody
KC-23324-03 1 mL

TNFRSF21 Antibody

Sign In for Pricing
View Details