Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Map Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Methionine aminopeptidase

Gene Aliases

B0168; ECK0166; methionine aminopeptidase; Peptidase M.

Gene ID

947882

Accession Number

NP_414710.1

Reactivity

Escherichia coli

Target

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val) . Requires deformylation of the N (alpha) -formylated initiator methionine before it can be hydrolyzed.

Type

Protein

Source

E.coli

Sequence

AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

45.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Map

Host or Source

Escherichia coli

Protein Name

Methionine aminopeptidase

Gene Name URL

Map

Nucleotide Accession Number

NC_000913.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX32 3'UTR Lenti-reporter-Luc Vector
45078081 1.0 µg

SNX32 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
RNASE2 (Non-secretory Ribonuclease, Eosinophil-derived Neurotoxin, RNase UpI-2, Ribonuclease 2, RNase 2, Ribonuclease US, EDN, RNS2) (Biotin)
R2022-03A-Biotin 100 µL

RNASE2 (Non-secretory Ribonuclease, Eosinophil-derived Neurotoxin, RNase UpI-2, Ribonuclease 2, RNase 2, Ribonuclease US, EDN, RNS2) (Biotin)

Sign In for Pricing
View Details
InstantBlot Transfer Buffer
NXB86500 500 mL

InstantBlot Transfer Buffer

Sign In for Pricing
View Details
Inhibitor mmu-miR-7059-5p AAV miRNA Vector
Amm3166500 500 ng

Inhibitor mmu-miR-7059-5p AAV miRNA Vector

Sign In for Pricing
View Details
Phospho-Ubiquitin Ser65 (30H3K1) Recombinant Chicken Chimeric mAb (BSA and Azide free) Antibody
orb3167118 100 µL

Phospho-Ubiquitin Ser65 (30H3K1) Recombinant Chicken Chimeric mAb (BSA and Azide free) Antibody

Sign In for Pricing
View Details
Cochlin shRNA (m) Lentiviral Particles
sc-60428-V 200 µL

Cochlin shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details