Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LptA Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Lipopolysaccharide transport system protein LptA

Gene Aliases

B3200; ECK3189; lipopolysaccharide transport system protein LptA; yhbN.

Gene ID

947920

Accession Number

NP_417667.1

Reactivity

Escherichia coli

Target

Involved in the assembly of lipopolysaccharide (LPS) . Required for the translocation of LPS from the inner membrane to the outer membrane. May form a bridge between the inner membrane and the outer membrane, via interactions with LptC and LptD, thereby facilitating LPS transfer across the periplasm.

Type

Protein

Source

E.coli

Sequence

VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQLQDKNNKGQTPAQKKGN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LptA

Host or Source

Escherichia coli

Protein Name

Lipopolysaccharide export system protein LptA

Gene Name URL

LptA

Nucleotide Accession Number

NC_000913.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCARNA10 sgRNA CRISPR Lentivector (Human) (Target 1)
K2096902 1.0 µg DNA

SCARNA10 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Mouse melanocortin2 receptor (MC2R) ELISA Kit
GTR10331203 96 Well

Mouse melanocortin2 receptor (MC2R) ELISA Kit

Sign In for Pricing
View Details
FXC1 Protein Vector (Mouse) (pPM-C-HA)
21088024 500 ng

FXC1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
IL21 (Interleukin-21, IL-21, Za11, Interleukin21) (MaxLight 750) discontinued
143617-ML750 100 µL

IL21 (Interleukin-21, IL-21, Za11, Interleukin21) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal CASK Antibody [Alexa Fluor 350]
NBP2-41181AF350 0.1 mL

Rabbit Polyclonal CASK Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
LGK-974 5mg
A12816-5 5 mg

LGK-974 5mg

Sign In for Pricing
View Details