Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LptA Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Lipopolysaccharide transport system protein LptA

Gene Aliases

B3200; ECK3189; lipopolysaccharide transport system protein LptA; yhbN.

Gene ID

947920

Accession Number

NP_417667.1

Reactivity

Escherichia coli

Target

Involved in the assembly of lipopolysaccharide (LPS) . Required for the translocation of LPS from the inner membrane to the outer membrane. May form a bridge between the inner membrane and the outer membrane, via interactions with LptC and LptD, thereby facilitating LPS transfer across the periplasm.

Type

Protein

Source

E.coli

Sequence

VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQLQDKNNKGQTPAQKKGN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LptA

Host or Source

Escherichia coli

Protein Name

Lipopolysaccharide export system protein LptA

Gene Name URL

LptA

Nucleotide Accession Number

NC_000913.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Perfringens trmB Protein (aa 1-219)
VAng-Lsx00898-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Perfringens trmB Protein (aa 1-219)

Sign In for Pricing
View Details
7420461P10Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
10855114 3x 1.0 µg

7420461P10Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
PHAF1 (NM_025187) Human Over-expression Lysate
LS080262 100 µg

PHAF1 (NM_025187) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Ufm1 (NM_026435) AAV Particle
MR200184A1V 250 µL

Mouse Ufm1 (NM_026435) AAV Particle

Sign In for Pricing
View Details
RANBP6 Antibody : FITC (OAAF04124-FITC)
OAAF04124-100UG-FITC 100 µg

RANBP6 Antibody : FITC (OAAF04124-FITC)

Sign In for Pricing
View Details
Recombinant Interleukin 23 Subunit Alpha (IL23a)
MBS2153822-01 0.01 mg

Recombinant Interleukin 23 Subunit Alpha (IL23a)

Sign In for Pricing
View Details