What is the catalog number for LptA Recombinant Protein?

The catalog number for LptA Recombinant Protein is OPCA02134-100UG.

What sizes are available for LptA Recombinant Protein?

LptA Recombinant Protein is available in the following size(s): 100 µg.

Is LptA Recombinant Protein in stock?

LptA Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

LptA Recombinant Protein

Selected Variant

OPCA02134-100UG

Size: 100 µg

Product Specifications

CAS Number

9000-83-3

Gene Name

Lipopolysaccharide transport system protein LptA

Gene Aliases

B3200; ECK3189; lipopolysaccharide transport system protein LptA; yhbN.

Gene ID

947920

Accession Number

NP_417667.1

Reactivity

Escherichia coli

Target

Involved in the assembly of lipopolysaccharide (LPS) . Required for the translocation of LPS from the inner membrane to the outer membrane. May form a bridge between the inner membrane and the outer membrane, via interactions with LptC and LptD, thereby facilitating LPS transfer across the periplasm.

Type

Protein

Source

E.coli

Sequence

VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQLQDKNNKGQTPAQKKGN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LptA

Host or Source

Escherichia coli

Protein Name

Lipopolysaccharide export system protein LptA

Gene Name URL

LptA

Nucleotide Accession Number

NC_000913.3

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD25 / IL2RA (Activated Lymphocyte Marker) (IL2RA/2394), CF488A conjugate, 0.1mg/mL

BNC882394-500 1x 500 µL