Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LptA Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Lipopolysaccharide transport system protein LptA

Gene Aliases

B3200; ECK3189; lipopolysaccharide transport system protein LptA; yhbN.

Gene ID

947920

Accession Number

NP_417667.1

Reactivity

Escherichia coli

Target

Involved in the assembly of lipopolysaccharide (LPS) . Required for the translocation of LPS from the inner membrane to the outer membrane. May form a bridge between the inner membrane and the outer membrane, via interactions with LptC and LptD, thereby facilitating LPS transfer across the periplasm.

Type

Protein

Source

E.coli

Sequence

VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQLQDKNNKGQTPAQKKGN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LptA

Host or Source

Escherichia coli

Protein Name

Lipopolysaccharide export system protein LptA

Gene Name URL

LptA

Nucleotide Accession Number

NC_000913.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

C16orf14 Protein Vector (Human) (pPM-C-HA)
13912023 500 ng

C16orf14 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
ZSCAN18 (Zinc Finger and SCAN Domain-containing Protein 18, Zinc Finger Protein 447, ZNF447) (MaxLight 405) discontinued
135741-ML405 100 µL

ZSCAN18 (Zinc Finger and SCAN Domain-containing Protein 18, Zinc Finger Protein 447, ZNF447) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Multiplex Assay Kit for Connective Tissue Growth Factor (CTGF), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0025041 96 Tests

Multiplex Assay Kit for Connective Tissue Growth Factor (CTGF), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
PRKRIR Protein Vector (Rat) (pPM-C-His)
PV296153 500 ng

PRKRIR Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
EEF1A2 siRNA (Rat)
CRR0299-01 15 nmol

EEF1A2 siRNA (Rat)

Sign In for Pricing
View Details
EEF1A2 siRNA (Rat)
CRR0299-02 30 nmol

EEF1A2 siRNA (Rat)

Sign In for Pricing
View Details