Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecR Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

DNA repair protein RecR

Gene Aliases

B0472; DNA repair protein RecR; ECK0466.

Gene ID

945100

Accession Number

NP_415005.1

Reactivity

Escherichia coli

Target

May play a role in DNA repair. It seems to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO.

Type

Protein

Source

E.coli

Sequence

MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RecR

Host or Source

Escherichia coli

Protein Name

Recombination protein RecR

Gene Name URL

RecR

Nucleotide Accession Number

NC_000913.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1B (LRP1B)
MBS2070053-01 0.1 mL

APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1B (LRP1B)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1B (LRP1B)
MBS2070053-02 0.2 mL

APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1B (LRP1B)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1B (LRP1B)
MBS2070053-03 0.5 mL

APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1B (LRP1B)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1B (LRP1B)
MBS2070053-04 1 mL

APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1B (LRP1B)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1B (LRP1B)
MBS2070053-05 5 mL

APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1B (LRP1B)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1B (LRP1B)
MBS2070053-06 5x 5 mL

APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1B (LRP1B)

Sign In for Pricing
View Details