Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha-trichosanthin Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

RRNA N-glycosidase.

Reactivity

Trichosanthes kirilowii

Target

Inactivates eukaryotic 60S ribosomal subunits.

Type

Protein

Source

E.coli

Sequence

DVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRSSLPGSQRYALIHLTNYADETISVAIDVTNVYIMGYRAGDTSYFFNEASATEAAKYVFKDAMRKVTLPYSGNYERLQTAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFESPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

43.1 kDa

Protein Length

Recombinant

Host or Source

Trichosanthes kirilowii

Protein Name

Ribosome-inactivating protein alpha-trichosanthin

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIGLEC11 Polyclonal Antibody, APC Conjugated
bs-20001R-APC 100 µL

SIGLEC11 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
WNT6 antibody
FNab09521 100 µg

WNT6 antibody

Sign In for Pricing
View Details
TTC21B (m) -PR
sc-154759-PR 10 µM - 20 µL

TTC21B (m) -PR

Sign In for Pricing
View Details
Human CTNS (NM_004937) AAV Particle
RC213151A1V 250 µL

Human CTNS (NM_004937) AAV Particle

Sign In for Pricing
View Details
5a-Androst-16-en-3-one (Androstenone)
259970-01 50 mg

5a-Androst-16-en-3-one (Androstenone)

Sign In for Pricing
View Details
5a-Androst-16-en-3-one (Androstenone)
259970-02 100 mg

5a-Androst-16-en-3-one (Androstenone)

Sign In for Pricing
View Details