Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

StxB2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Shiga toxin Stx2a subunit B

Gene Aliases

L0104; Shiga toxin Stx2a subunit B; sltIIB; ST933Wp41; stx2B; Verocytotoxin 2 subunit B.

Gene ID

1262010

Accession Number

NP_049501.1

Reactivity

Enterobacteria phage 933W|Escherichia phage 933W

Target

The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.

Type

Protein

Source

E.coli

Sequence

ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

23.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

StxB2

Host or Source

Enterobacteria phage

Protein Name

Shiga-like toxin 2 subunit B

Gene Name URL

StxB2

Nucleotide Accession Number

NC_000924.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atp2a3 ORF Vector (Mouse) (pORF)
12685015 1.0 µg DNA

Atp2a3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
COX4I1 Protein, Human, Recombinant (His & SUMO)
TMPH-01179-01 5 µg

COX4I1 Protein, Human, Recombinant (His & SUMO)

Sign In for Pricing
View Details
COX4I1 Protein, Human, Recombinant (His & SUMO)
TMPH-01179-02 10 µg

COX4I1 Protein, Human, Recombinant (His & SUMO)

Sign In for Pricing
View Details
COX4I1 Protein, Human, Recombinant (His & SUMO)
TMPH-01179-03 20 µg

COX4I1 Protein, Human, Recombinant (His & SUMO)

Sign In for Pricing
View Details
COX4I1 Protein, Human, Recombinant (His & SUMO)
TMPH-01179-04 50 µg

COX4I1 Protein, Human, Recombinant (His & SUMO)

Sign In for Pricing
View Details
COX4I1 Protein, Human, Recombinant (His & SUMO)
TMPH-01179-05 100 µg

COX4I1 Protein, Human, Recombinant (His & SUMO)

Sign In for Pricing
View Details