Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tar Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Methyl-accepting chemotaxis protein Tar

Gene Aliases

Aspartate chemoreceptor protein; b1886; cheM; ECK1887; methyl-accepting chemotaxis protein Tar.

Gene ID

946399

Accession Number

NP_416400.1

Reactivity

Escherichia coli

Target

Receptor for the attractant L-aspartate and related amino and dicarboxylic acids. Tar also mediates taxis to the attractant maltose via an interaction with the periplasmic maltose binding protein. Tar mediates taxis away from the repellents cobalt and nickel.

Type

Protein

Source

E.coli

Sequence

IRRMLLTPLAKIIAHIREIAGGNLANTLTIDGRSEMGDLAQSVSHMQRSLTDTVTHVREGSDAIYAGTREIAAGNTDLSSRTEQQASALEETAASMEQLTATVKQNADNARQASQLAQSASDTAQHGGKVVDGVVKTMHEIADSSKKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKALIEDSVSRVDTGSVLVESAGETMNNIVNAVTRVTDIMGEIASASDEQSRGIDQVALAVSEMDRVTQQNASLVQESAAAAAALEEQASRLTQAVSAFRLAASPLTNKPQTPSRPASEQPPAQPRLRIAEQDPNWETF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

52 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Tar

Host or Source

Escherichia coli

Protein Name

Methyl-accepting chemotaxis protein II

Gene Name URL

Tar

Nucleotide Accession Number

NC_000913.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VSX2 3'UTR GFP Stable Cell Line
TU078326 1.0 mL

VSX2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-SLC4A5 antibody
STJ112467 100 µl

Anti-SLC4A5 antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS611075 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
GLCE Antibody - middle region
MBS3221219-01 0.1 mL

GLCE Antibody - middle region

Sign In for Pricing
View Details
GLCE Antibody - middle region
MBS3221219-02 5x 0.1 mL

GLCE Antibody - middle region

Sign In for Pricing
View Details
Recombinant Human Apolipoprotein A5 (APOA5)
RPU40341-01 50 µg

Recombinant Human Apolipoprotein A5 (APOA5)

Sign In for Pricing
View Details