Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cry1Ac Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

133 kDa crystal protein; Crystaline entomocidal protoxin; Insecticidal delta-endotoxin CryIA (c) .

Reactivity

Bacillus thuringiensis

Target

Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.

Type

Protein

Source

E.coli

Sequence

LYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

50.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CRY1AC

Host or Source

Bacillus thuringiensis subsp. Kurstaki

Protein Name

Pesticidal crystal protein Cry1Ac

Gene Name URL

CRY1AC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Netrin receptor UNC5B (UNC5B) Antibody (HRP)
abx336736-01 20 µg

Netrin receptor UNC5B (UNC5B) Antibody (HRP)

Sign In for Pricing
View Details
Netrin receptor UNC5B (UNC5B) Antibody (HRP)
abx336736-02 50 µg

Netrin receptor UNC5B (UNC5B) Antibody (HRP)

Sign In for Pricing
View Details
Netrin receptor UNC5B (UNC5B) Antibody (HRP)
abx336736-03 100 µg

Netrin receptor UNC5B (UNC5B) Antibody (HRP)

Sign In for Pricing
View Details
Netrin receptor UNC5B (UNC5B) Antibody (HRP)
abx336736-04 200 µg

Netrin receptor UNC5B (UNC5B) Antibody (HRP)

Sign In for Pricing
View Details
Netrin receptor UNC5B (UNC5B) Antibody (HRP)
abx336736-05 1 mg

Netrin receptor UNC5B (UNC5B) Antibody (HRP)

Sign In for Pricing
View Details
Bovine DNA Damage-Inducible Transcript 4 (DDIT4) ELISA Kit
OM618718 96 Strip Well

Bovine DNA Damage-Inducible Transcript 4 (DDIT4) ELISA Kit

Sign In for Pricing
View Details