Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TetX Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Tetanus neurotoxin TetX

Gene Aliases

CTC_p60; CTC_RS14060; pE88_60; Tentoxylysin; tetanus neurotoxin TetX.

Gene ID

24255210

Accession Number

WP_011100836.1

Reactivity

Clostridium tetani

Target

Tetanus toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase that catalyzes the hydrolysis of the '76-Gln-|-Phe-77' bond of synaptobrevin-2.

Type

Protein

Source

E.coli

Sequence

PITINNFRYSDPVNNDTIIMMEPPYCKGLDIYYKAFKITDRIWIVPERYEFGTKPEDFNPPSSLIEGASEYYDPNYLRTDSDKDRFLQTMVKLFNRIKNNVAGEALLDKIINAIPYLGNSYSLLDKFDTNSNSVSFNLLEQDPSGATTKSAMLTNLIIFGPGPVLNKNEVRGIVLRVDNKNYFPCRDGFGSIMQMAFCPEYVPTFDNVIENITSLTIGKSKYFQDPALLLMHELIHVLHGLYGMQVSSHEIIPSKQEIYMQHTYPISAEELFTFGGQDANLISIDIKNDLYEKTLNDYKAIANKLSQVTSCNDPNIDIDSYKQIYQQKYQFDKDSNGQYIVNEDKFQILYNSIMYGFTEIELGKKFNIKTRLSYFSMNHDPVKIPNLLDDTIYNDTEGFNIESKDLKSEYKGQNMRVNTNAFRNVDGSGLVSKLIGLCKKIIPPTNIRENLYNRTA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

66.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TetX

Host or Source

Clostridium tetani

Protein Name

Tetanus toxin

Gene Name URL

TetX

Nucleotide Accession Number

NC_004565.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC27 Antibody - N-terminal region : HRP (ARP57019_P050-HRP)
ARP57019_P050-HRP 100 µL

TTC27 Antibody - N-terminal region : HRP (ARP57019_P050-HRP)

Sign In for Pricing
View Details
DDX59 Conjugated Antibody
MBS9454905-01 0.1 mL (Biotin)

DDX59 Conjugated Antibody

Sign In for Pricing
View Details
DDX59 Conjugated Antibody
MBS9454905-02 0.1 mL (AF350)

DDX59 Conjugated Antibody

Sign In for Pricing
View Details
DDX59 Conjugated Antibody
MBS9454905-03 0.1 mL (AF405)

DDX59 Conjugated Antibody

Sign In for Pricing
View Details
DDX59 Conjugated Antibody
MBS9454905-04 0.1 mL (AF488)

DDX59 Conjugated Antibody

Sign In for Pricing
View Details
DDX59 Conjugated Antibody
MBS9454905-05 0.1 mL (AF555)

DDX59 Conjugated Antibody

Sign In for Pricing
View Details