Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BALF5 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

DNA polymerase catalytic subunit

Gene Aliases

DNA polymerase catalytic subunit; HHV4_BALF5.

Gene ID

3783681

Accession Number

YP_401712.1

Reactivity

Epstein-Barr virus|Epstein-Barr Virus|Human Gammaherpesvirus 4

Target

Replicates viral genomic DNA in the late phase of lytic infection, producing long concatemeric DNA. The replication complex is composed of six viral proteins: the DNA polymerase, processivity factor, primase, primase-associated factor, helicase, and ssDNA-binding protein.

Type

Protein

Source

E.coli

Sequence

MSGGLFYNPFLRPNKGLLKKPDKEYLRLIPKCFQTPGAAGVVDVRGPQPPLCFYQDSLTVVGGDEDGKGMWWRQRAQEGTARPEADTHGSPLDFHVYDILETVYTHEKCAVIPSDKQGYVVPCGIVIKLLGRRKADGASVCVNVFGQQAYFYASAPQGLDVEFAVLSALKASTFDRRTPCRVSVEKVTRRSIMGYGNHAGDYHKITLSHP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

BALF5

Host or Source

Epstein-Barr virus

Protein Name

DNA polymerase catalytic subunit

Gene Name URL

BALF5

Nucleotide Accession Number

NC_007605.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM117 (NM_032256) Human Over-expression Lysate
E45H12698-2 20 µg

TMEM117 (NM_032256) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal SHROOM1 Antibody
NBP2-32696-25ul 25 µL

Rabbit Polyclonal SHROOM1 Antibody

Sign In for Pricing
View Details
Anti-Galc antibody
PAab03305 100 µg

Anti-Galc antibody

Sign In for Pricing
View Details
C17orf49 CRISPR Knock Out 293T Cell Line (Human)
13976141 1x 10^6 Cells / 1.0 mL

C17orf49 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Usp29 (NM_001108465) Rat Tagged ORF Clone Lentiviral Particle
RR215263L4V 200 µL

Usp29 (NM_001108465) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rat S100A4 Matched Antibody Pair Set [ABP-S-04940]
ABP-S-04940 5 Plates

Rat S100A4 Matched Antibody Pair Set [ABP-S-04940]

Sign In for Pricing
View Details