Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-mammal toxin Cn2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Toxin II.9.2.2.

Reactivity

Centruroides noxius

Target

Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals.

Type

Protein

Source

E.coli

Sequence

KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

23.6 kDa

Protein Length

Recombinant

Host or Source

Centruroides noxius

Protein Name

Beta-mammal toxin Cn2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CFL1, Phosphorylated (S3) (Cofilin 1, CFL, p18) (Biotin)
MBS6411351-01 0.1 mL

CFL1, Phosphorylated (S3) (Cofilin 1, CFL, p18) (Biotin)

Sign In for Pricing
View Details
CFL1, Phosphorylated (S3) (Cofilin 1, CFL, p18) (Biotin)
MBS6411351-02 5x 0.1 mL

CFL1, Phosphorylated (S3) (Cofilin 1, CFL, p18) (Biotin)

Sign In for Pricing
View Details
BHLHE23 Human qPCR Primer Pair (NM_080606)
HP216688 200 Reactions

BHLHE23 Human qPCR Primer Pair (NM_080606)

Sign In for Pricing
View Details
Fam82b-set siRNA/shRNA/RNAi Lentivector (Mouse)
20139094 4x 500 ng

Fam82b-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Rabbit Polyclonal to Human TK1 / TK / Thymidine Kinase
MBS241732-01 0.05 mg

Rabbit Polyclonal to Human TK1 / TK / Thymidine Kinase

Sign In for Pricing
View Details
Rabbit Polyclonal to Human TK1 / TK / Thymidine Kinase
MBS241732-02 5x 0.05 mg

Rabbit Polyclonal to Human TK1 / TK / Thymidine Kinase

Sign In for Pricing
View Details