What is the catalog number for PNP Recombinant Protein?

The catalog number for PNP Recombinant Protein is OPCA02100-100UG.

What sizes are available for PNP Recombinant Protein?

PNP Recombinant Protein is available in the following size(s): 100 µg.

Is PNP Recombinant Protein in stock?

PNP Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

PNP Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Purine nucleoside phosphorylase

Gene Aliases

Epididymis secretory sperm binding protein Li 156an; HEL-S-156an; inosine phosphorylase; inosine-guanosine phosphorylase; NP; PRO1837; PUNP; purine nucleoside phosphorylase; purine-nucleoside:orthophosphate ribosyltransferase.

Gene ID

4860

Accession Number

NP_000261.2

Reactivity

Homo sapiens|Human

Target

The purine nucleoside phosphorylases catalyze the phosphorolytic breakdown of the N-glycosidic bond in the beta- (deoxy) ribonucleoside molecules, with the formation of the corresponding free purine bases and pentose-1-phosphate.

Type

Protein

Source

E.coli

Sequence

MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.