Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyp125 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Steroid C26-monooxygenase

Gene Aliases

Cholest-4-en-3-one 26-monooxygenase; Cholest-4-en-3-one C26-monooxygenase [ (25S) -3-oxocholest-4-en-26-oate forming]; Cholesterol C26-monooxygenase; Cholesterol C26-monooxygenase [ (25S) -3beta-hydroxycholest-5-en-26-oate forming]; Cytochrome P450 125; Rv3545c; steroid C26-monooxygenase; Steroid C27-monooxygenase.

Gene ID

887782

Accession Number

NP_218062.1

Reactivity

Mycobacterium tuberculosis

Target

Involved in the utilization of cholesterol as the sole carbon and energy source by degrading the side chain during infection (PubMed:20843794, PubMed:20545858) . Primarily catalyzes the sequential oxidation of the terminal methyl of cholest-4-en-3-one into (25S) -26-hydroxycholest-4-en-3-one (alcohol), (25S) -26-oxocholest-4-en-3-one (aldehyde), to finally yield the carboxylic acid (25S) -3-oxocholest-4-en-26-oate (PubMed:19846551, PubMed:20843794, PubMed:20545858) . Also able to sequentially oxidize cholesterol itself, not only cholest-4-en-3-one (PubMed:19846551, PubMed:20843794, PubMed:20545858) .

Type

Protein

Source

E.coli

Sequence

MSWNHQSVEIAVRRTTVPSPNLPPGFDFTDPAIYAERLPVAEFAELRSAAPIWWNGQDPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSSYENGVIPRFKNDIAREDIEVQRFVMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKIAAEAAAAGSGDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEMTGNEDPEYAHIDPKASSAELIGYAMKMAEEKAKNPADDIVTQLIQADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQWELYKKVRPETAADEIVRWATPVTAFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILRNPNPHVGFGGTGAHYCIGANLARMTINLIFNAVADHMPDLKPISAPERLRSGWLNGIKHWQVDYTGRCPVAH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

64.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Cyp125

Host or Source

Mycobacterium tuberculosis

Protein Name

Steroid C26-monooxygenase

Gene Name URL

Cyp125

Nucleotide Accession Number

NC_000962.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASS1 Mouse Monoclonal Antibody [Clone ID: OTI8C4]
CF809122 100 µg

ASS1 Mouse Monoclonal Antibody [Clone ID: OTI8C4]

Sign In for Pricing
View Details
NUMBL Human Gene Knockout Kit (CRISPR)
KN416869 1 Kit

NUMBL Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tapbp Rabbit Polyclonal Antibody
TA363260 100 µL

Tapbp Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SFTPC (NM_001172357) Human Over-expression Lysate
LY432661 100 µg

SFTPC (NM_001172357) Human Over-expression Lysate

Sign In for Pricing
View Details
SLAM / CD150 Recombinant Rabbit monoclonal Antibody
HA751437 100 µL

SLAM / CD150 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
HTR1D (NM_000864) Human Over-expression Lysate
LC424478 20 µg

HTR1D (NM_000864) Human Over-expression Lysate

Sign In for Pricing
View Details