What is the catalog number for Selt Recombinant Protein?

The catalog number for Selt Recombinant Protein is OPCA02094-1MG.

What sizes are available for Selt Recombinant Protein?

Selt Recombinant Protein is available in the following size(s): 1 mg.

Is Selt Recombinant Protein in stock?

Selt Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Selt Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Selenoprotein T

Gene Aliases

2810407C02Rik;5730408P04Rik; Se; Selt; thioredoxin reductase-like enzyme; thioredoxin reductase-like selenoprotein T.

Gene ID

69227

Accession Number

NP_001035486.2

Reactivity

Mouse|Mus musculus

Target

Selenoprotein with thioredoxin reductase-like oxidoreductase activity (By similarity) . Protects dopaminergic neurons against oxidative stress ans cell death (PubMed:26866473) . Involved in ADCYAP1/PACAP-induced calcium mobilization and neuroendocrine secretion (By similarity) . Plays a role in fibroblast anchorage and redox regulation (PubMed:19935881) . In gastric smooth muscle, modulates the contraction processes through the regulation of calcium release and MYLK activation (By similarity) . In pancreatic islets, involved in the control of glucose homeostasis, contributes to prolonged ADCYAP1/PACAP-induced insulin secretion (PubMed:23913443) .

Type

Protein

Source

E.coli

Sequence

SANLGGVPSKRLKMQYATGPLLKFQICVSSGYRRVFEEYMRVISQRYPDIRIEGENYLPQPIYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQWGQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDSIPHHRS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.