Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-mammal toxin Css4 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Css IV.

Reactivity

Centruroides suffusus

Target

Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals.

Type

Protein

Source

E.coli

Sequence

KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

23.6 kDa

Protein Length

Recombinant

Host or Source

Centruroides suffusus suffusus

Protein Name

Beta-mammal toxin Css4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aspn (NM_025711) Mouse Tagged ORF Clone Lentiviral Particle
MR205760L4V 200 µL

Aspn (NM_025711) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
NAB1 (NM_005966) Human Untagged Clone
SC110956 10 µg

NAB1 (NM_005966) Human Untagged Clone

Sign In for Pricing
View Details
G2E3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0826408 1.0 µg DNA

G2E3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
PITPNM1 Rabbit Polyclonal Antibody (N-term)
E28PB1605 100 µL

PITPNM1 Rabbit Polyclonal Antibody (N-term)

Sign In for Pricing
View Details
Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) PSY4 Polyclonal Antibody
MBS7197776 Inquire

Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) PSY4 Polyclonal Antibody

Sign In for Pricing
View Details
KbaZ Antibody
orb819404 2 mg

KbaZ Antibody

Sign In for Pricing
View Details