Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAP3K7CL Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

MAP3K7 C-terminal like

Gene Aliases

C21orf7; HC21ORF7; MAP3K7 C-terminal-like protein; TAK1L; TAK1-like protein; TAK1-like protein 1; TAK1-like protein 2; TAK1-like protein 4; TAKL; TAKL-1; TAKL-2; TAKL-4; TGF-beta activated kinase.

Gene ID

56911

Accession Number

NP_001273546.1

Reactivity

Homo sapiens|Human

Type

Protein

Source

E.coli

Sequence

MISTARVPADKPVRIAFSLNDASDDTPPEDSIPLVFPELDQQLQPLPPCHDSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEALTEENRTLRLAQSQCVEQLEKLRIQYQKRQGSS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

32.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MAP3K7CL

Host or Source

Human

Protein Name

MAP3K7 C-terminal-like protein

Gene Name URL

MAP3K7CL

Nucleotide Accession Number

NM_001286617.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PPM1M shRNA (UAS) - Lentiviral human PPM1M shRNA (UAS, iRFP) (25)
GTR15340985 1 Vial

Lentiviral human PPM1M shRNA (UAS) - Lentiviral human PPM1M shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
BCL2L12 Recombinant Antibody, Cy5 Conjugated
bsm-62094R-Cy5-01 20 µL

BCL2L12 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
BCL2L12 Recombinant Antibody, Cy5 Conjugated
bsm-62094R-Cy5-02 100 µL

BCL2L12 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Pcbp3 (NM_021568) Mouse Tagged Lenti ORF Clone
MR217582L3 10 µg

Pcbp3 (NM_021568) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TP53, Phosphorylated (S33) (Tumor Protein p53, P53, BCC7, LFS1, TRP53) (MaxLight 750)
MBS6441333-01 0.1 mL

TP53, Phosphorylated (S33) (Tumor Protein p53, P53, BCC7, LFS1, TRP53) (MaxLight 750)

Sign In for Pricing
View Details
TP53, Phosphorylated (S33) (Tumor Protein p53, P53, BCC7, LFS1, TRP53) (MaxLight 750)
MBS6441333-02 5x 0.1 mL

TP53, Phosphorylated (S33) (Tumor Protein p53, P53, BCC7, LFS1, TRP53) (MaxLight 750)

Sign In for Pricing
View Details