Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TES-26 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Toxocara excretory-secretory antigen 26.

Reactivity

Toxocara canis

Target

Binds phosphatidylethanolamine.

Type

Protein

Source

E.coli

Sequence

QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

41.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TES-26

Host or Source

Toxocara canis

Protein Name

26 kDa secreted antigen

Gene Name URL

TES-26

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histidine-rich Glycoprotein, NT (HRG, HRGP, Histidine-proline-rich Glycoprotein, HPRG) (MaxLight 550)
MBS6480486-01 0.1 mL

Histidine-rich Glycoprotein, NT (HRG, HRGP, Histidine-proline-rich Glycoprotein, HPRG) (MaxLight 550)

Sign In for Pricing
View Details
Histidine-rich Glycoprotein, NT (HRG, HRGP, Histidine-proline-rich Glycoprotein, HPRG) (MaxLight 550)
MBS6480486-02 5x 0.1 mL

Histidine-rich Glycoprotein, NT (HRG, HRGP, Histidine-proline-rich Glycoprotein, HPRG) (MaxLight 550)

Sign In for Pricing
View Details
CD253, B-S23; IgG1; Azide free
M853080000 200 µg / 200 µL

CD253, B-S23; IgG1; Azide free

Sign In for Pricing
View Details
Interleukin-5, active (Il5), Recombinant, Mouse
348145 5 µg

Interleukin-5, active (Il5), Recombinant, Mouse

Sign In for Pricing
View Details
TTC30B Mouse Monoclonal Antibody [Clone ID: LBI1H1]
AMM21744VCF 100 µg

TTC30B Mouse Monoclonal Antibody [Clone ID: LBI1H1]

Sign In for Pricing
View Details
Rabbit Anti-PMF1 antibody
SL9319R-01 50 µL

Rabbit Anti-PMF1 antibody

Sign In for Pricing
View Details