Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TES-26 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Toxocara excretory-secretory antigen 26.

Reactivity

Toxocara canis

Target

Binds phosphatidylethanolamine.

Type

Protein

Source

E.coli

Sequence

QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

41.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TES-26

Host or Source

Toxocara canis

Protein Name

26 kDa secreted antigen

Gene Name URL

TES-26

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant other TXN2 Yeast Protein, Untagged, E.coli-20ug
QP10903-20ug 20ug

Recombinant other TXN2 Yeast Protein, Untagged, E.coli-20ug

Sign In for Pricing
View Details
KLF10 (NM_005655) Human Recombinant Protein
TP760221 50 µg

KLF10 (NM_005655) Human Recombinant Protein

Sign In for Pricing
View Details
TREML1 Polyclonal Conjugated Antibody
MBS9439316-01 0.1 mL (Biotin)

TREML1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
TREML1 Polyclonal Conjugated Antibody
MBS9439316-02 0.1 mL (AF350)

TREML1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
TREML1 Polyclonal Conjugated Antibody
MBS9439316-03 0.1 mL (AF405)

TREML1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
TREML1 Polyclonal Conjugated Antibody
MBS9439316-04 0.1 mL (AF488)

TREML1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details