Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UspF Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Nucleotide binding filament protein

Gene Aliases

B1376; ECK1371; nucleotide binding filament protein; UP03; ynaF; yzzL.

Gene ID

945948

Reactivity

Escherichia coli

Type

Protein

Source

E.coli

Sequence

MNRTILVPIDISDSELTQRVISHVEEEAKIDDAEVHFLTVIPSLPYYASLGLAYSAELPAMDDLKAEAKSQLEEIIKKFKLPTDRVHVHVEEGSPKDRILELAKKIPAHMIIIASHRPDITTYLLGSNAAAVVRHAECSVLVVR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

32 kDa

Protein Length

Recombinant

NCBI Gene Symbol

UspF

Host or Source

Escherichia coli

Protein Name

Universal stress protein F

Gene Name URL

UspF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytidine-5'-triphosphate disodium salt 98+% (HPLC)
237041-01 250 mg

Cytidine-5'-triphosphate disodium salt 98+% (HPLC)

Sign In for Pricing
View Details
Cytidine-5'-triphosphate disodium salt 98+% (HPLC)
237041-02 1 g

Cytidine-5'-triphosphate disodium salt 98+% (HPLC)

Sign In for Pricing
View Details
Cytidine-5'-triphosphate disodium salt 98+% (HPLC)
237041-03 5 g

Cytidine-5'-triphosphate disodium salt 98+% (HPLC)

Sign In for Pricing
View Details
Cytidine-5'-triphosphate disodium salt 98+% (HPLC)
237041-04 10 g

Cytidine-5'-triphosphate disodium salt 98+% (HPLC)

Sign In for Pricing
View Details
Cytidine-5'-triphosphate disodium salt 98+% (HPLC)
237041-05 25 g

Cytidine-5'-triphosphate disodium salt 98+% (HPLC)

Sign In for Pricing
View Details
GENLISA™ Human 1-phosphatidylinositol-4, 5-bisphosphate phosphodiesterase Beta-1 (PLCB1) ELISA
KBH4871 1x 96 Well

GENLISA™ Human 1-phosphatidylinositol-4, 5-bisphosphate phosphodiesterase Beta-1 (PLCB1) ELISA

Sign In for Pricing
View Details