Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMPR Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Guanosine monophosphate reductase

Gene Aliases

GMP reductase 1; GMPR 1; GMPR1; guanine monophosphate reductase; guanosine 5'-monophosphate oxidoreductase 1; guanosine monophosphate reductase 1.

Gene ID

2766

Accession Number

NP_006868.3

Reactivity

Homo sapiens|Human

Target

Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides.

Type

Protein

Source

E.coli

Sequence

MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

53.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GMPR

Host or Source

Human

Protein Name

GMP reductase 1

Gene Name URL

GMPR

Nucleotide Accession Number

NM_006877.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-LAMP2 Antibody Picoband®, Dylight550 Conjugate
A01573-3-Dylight550 100 µg

Anti-LAMP2 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
P21 / WAF1 (HJ21), 1mg/mL
BNUM0984-50 1x 50 µL

P21 / WAF1 (HJ21), 1mg/mL

Sign In for Pricing
View Details
Lentiviral human SUN1 shRNA (UAS) - Lentiviral human SUN1 shRNA (UAS, RFP) (100)
GTR15151320 1 Vial

Lentiviral human SUN1 shRNA (UAS) - Lentiviral human SUN1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
ACE inhibitor Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-0203R-BF647 100 µL

ACE inhibitor Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Anti-PHD1/EGLN2 Antibody
A03015 100 µL

Anti-PHD1/EGLN2 Antibody

Sign In for Pricing
View Details
Human Epidemic Hemorrhagic Fever IgM (EHF IgM) ELISA Kit
abx054768 96 Tests

Human Epidemic Hemorrhagic Fever IgM (EHF IgM) ELISA Kit

Sign In for Pricing
View Details