Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E7 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

E7Protein E7

Reactivity

Human papillomavirus type 52|Human Papillomavirus Type 52

Target

Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta) .

Type

Protein

Source

E.coli

Sequence

MRGDKATIKDYILDLQPETTDLHCYEQLGDSSDEEDTDGVDRPDGQAEQATSNYYIVTYCHSCDSTLRLCIHSTATDLRTLQQMLLGTLQVVCPGCARL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

27 kDa

Protein Length

Recombinant

NCBI Gene Symbol

E7

Host or Source

Human papillomavirus type 52

Protein Name

Protein E7

Gene Name URL

E7

More Discoveries

Explore Other Products

Browse additional items from our catalog

n-Octylbenzene
25515-84 10 g

n-Octylbenzene

Sign In for Pricing
View Details
Rabbit anti-MEK2 Recombinant Monoclonal Antibody [BLR079G]
A700-079-T 10 µL (5+ Tests)

Rabbit anti-MEK2 Recombinant Monoclonal Antibody [BLR079G]

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2615), CF488A conjugate, 0.1mg/mL
BNC882615-100 1x 100 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2615), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human IKBA (His)
orb3067942 50 µg

Recombinant Human IKBA (His)

Sign In for Pricing
View Details
F110A, NT (FAM110A, C20orf55, F10, Protein FAM110A) (MaxLight 550)
MBS6297324-01 0.1 mL

F110A, NT (FAM110A, C20orf55, F10, Protein FAM110A) (MaxLight 550)

Sign In for Pricing
View Details
F110A, NT (FAM110A, C20orf55, F10, Protein FAM110A) (MaxLight 550)
MBS6297324-02 5x 0.1 mL

F110A, NT (FAM110A, C20orf55, F10, Protein FAM110A) (MaxLight 550)

Sign In for Pricing
View Details